Pharmaceutical peptides Sermorelin Acetate

Product Details

Appearance:White powder

Throughput:100|Kilogram|Month

Application:Active pharmaceutical ingredients (APIs)

Delivery Time:3-5working days

Product Name:	Sermorelin
Synonyms:	SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;growth hormone releasing factor*fragment 1-29 ami;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN
CAS:	86168-78-7
MF:	C149H246N44O42S
MW:	3357.88

 

 

Other related products we can supply
cjc1295	Melanotan-II	TB500	Hexarelin	Tesamorelin
cjc1295 dac	ghrp-2	HGH176-191	BPC 157	Gonadorelin
PT-141	ghrp-6	Triptorelin	sermorelin	MGF
Melanotan-I	Ipamorelin	Selank	oxytocin	Epitalon
Alarelin Acetate	Octreotide	Gonadorelin Acetate	Secretin Acetate	Desmopressin Acetate
Angiotensin Acetate	Ornipressin Acetate	Leuprorelin Acetate	Atosiban Acetate	Terlipressin Acetate
Argpressin Acetate	Oxytocin Acetate	Lysipressin Acetate	SNAP-8	Salmon Calcitonin Acetate
Deslorelin Acetate	Eptifibatide Acetate	Oxytocin Acetate	Copper Peptide	Bivalirudin Trifluoroacetate

 

If you would like to order goods from our company,below process for your reference.

 

1,Choose the items that you are interested in,and the quantity you would like to order with each items,then send your inquiry to us by email or fax.Make sure that you have an accurate contact method especially a workable email address.If you need to know the shipping cost,pls let us know the name of the international port close to you.

2,We will reply you within 24hours.Again,your detail description on the potential order and your business background would be very helpful to an efficient reply.

3,You can have free samples up to US$5 in value.Any sample required beyond this value will be charged.Also you are required o pay for the sample delivery cost by courier(DHL,UPS,TNT,Fedex,EMS..)

4,Once you confirmed the order content,we will send you a proforma invocie (include the products no,quantity,price,freight charge,total amount and bank info.).After you confirmed this PI and send us the feedback and the bank transfer proof,we will arrange this order.

5,Once the payment has confirmed,we will ship the goods to you as soon as possible.

6,After delivery the goods,for courier we will give you one tracking no.and told you how to track it on the internet.

For sea,we will fax or send you the B/L or the file that you needed.

For air,we will fax you the airway bill.　

Please read all terms before purchasing, by purchasing this product you agree to all terms.

For oversea shipping,it's need the import tax.pls contact with your local courier.